PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00133_0190
Common NameKFL_001330190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family MYB
Protein Properties Length: 889aa    MW: 99462.1 Da    PI: 4.9858
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00133_0190genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.38.8e-14550248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g W   Ede+l+ av ++G+++W++I++ +  ++++kqck rw+ +l
    kfl00133_0190  5 GVWKNTEDEILKAAVMKYGKNQWARISSLLV-RKSAKQCKARWYEWL 50
                     78*****************************.************986 PP

2Myb_DNA-binding31.83.4e-1057100248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT eEde+l++  k++++  W+tIa  +g  Rt+ qc +r+ k+l
    kfl00133_0190  57 TEWTREEDEKLLHMAKLMPTQ-WRTIAPIVG--RTPAQCLERYEKLL 100
                      68*****************99.********8..**********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.223154IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-18254IPR009057Homeodomain-like
SMARTSM007177.0E-15352IPR001005SANT/Myb domain
CDDcd001671.30E-11750No hitNo description
PfamPF139214.7E-13767No hitNo description
SuperFamilySSF466899.35E-2130104IPR009057Homeodomain-like
CDDcd116592.45E-3052103No hitNo description
SMARTSM007174.0E-1255102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-1355101IPR009057Homeodomain-like
PROSITE profilePS5129416.0555104IPR017930Myb domain
PfamPF118311.1E-59400637IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009870Biological Processdefense response signaling pathway, resistance gene-dependent
GO:0010204Biological Processdefense response signaling pathway, resistance gene-independent
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0051301Biological Processcell division
GO:0009507Cellular Componentchloroplast
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 889 aa     Download sequence    Send to blast
MIKGGVWKNT EDEILKAAVM KYGKNQWARI SSLLVRKSAK QCKARWYEWL DPSIKKTEWT  60
REEDEKLLHM AKLMPTQWRT IAPIVGRTPA QCLERYEKLL DAAAAKDEAY DPADDPRKLR  120
PGEIDPNPES KPARPDPVDM DEDEKEMLSE ARARLANTRG KKAKRKAREK QLEEARRLAS  180
LQKKRELKAA GIELQYRKKK SKGVDYNAEI PFERKAPAGF YDVSGEEGPA VDPNFVNVNL  240
DELEGKRRVD MEALLRKQDE ERQRRREAQD MPGVVMEINK MNDPEQVRKR SKLMLPAPQI  300
SDRELEEIAK LDYANDLLLE AEGGDGATRA LLASYGRTPG ATPLRTPART PGGTGDAIMM  360
EAENLARLRE MNTPLFGGEN PTLHASDFSG ITPKRSVVQT PNPIATPLRT PGGLIGMTPG  420
ATPAGRGVGM TPGRTPIRDE LRINDGSETP MSASARAEKL RQAEQRQHLR AGLTNLPAPK  480
MDYQIMVPEL PGDDEEVEHM EEDAADVIMR QQEAQAAAEA AALRKRSSAI KRALPRPADV  540
STFTKTLQEE LGDDVVPATK LELADRLVKA EMLALLEHDA VKYPVEDGRK KKGPHANGGA  600
PMEAPALEDV DEEDLKEAEF LIAEEADILR SLWGHDAKEE DEYVETWEAV YSDYVWLPTQ  660
CRYELASVSN NADKLAAAQA EFERLKKQIE VELKRAQKLE TKIGMVHGGY QMKAKEKWSA  720
VEATYKQADI LGTELECFKA LFRQEQLSIP RRIESLKEDV RGQSERERSL QLWYENLLVE  780
QEDLQRKIDE HEKGLTAAKR AAEERAAEEA KRHEEEIREK HRKEAEEAES VRAEKGEVSG  840
RQSTPADGAE NGENNNEDEE MVGPQVAMPA ANANGPAEDG KNGEAIGAG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-10112213236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1182199KKRELKAAGIELQYRKKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00028SELEXTransfer from AT1G09770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246794.10.0PREDICTED: cell division cycle 5-like protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLA0A0U9HRM10.0A0A0U9HRM1_KLEFL; Cell division control protein
STRINGGSMUA_Achr9P23340_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP39481723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5
Publications ? help Back to Top
  1. Hori K, et al.
    Klebsormidium flaccidum genome reveals primary factors for plant terrestrial adaptation.
    Nat Commun, 2014. 5: p. 3978
    [PMID:24865297]